PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ahy008989
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family GRAS
Protein Properties Length: 445aa    MW: 49064.6 Da    PI: 6.3655
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Ahy#S59548734PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS166.71.9e-512974451148
       GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshltaN 99 
                lv+lL++c+ea+ +++ +++++++a+l +lasp+g ++m R+ +yfteALa r++r +++++++  p+e ++  ++e+ +al+l+++++Pi+kf h+t N
  Ahy008989 297 LVSLLTACVEAIGTKNIAAINHFIAKLGDLASPRGtSSMSRICSYFTEALAIRVTRLWPHIFHITIPRELDRVVEDENGTALRLLNQITPIPKFLHFTSN 396
                6899*******************************889*********************************999************************** PP

       GRAS 100 qaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvg 148
                +++l+a+eg++rvHiiDfdi+qGlQWp+L+q+LasR+++p ++RiTg+g
  Ahy008989 397 EMLLRAFEGKDRVHIIDFDIKQGLQWPSLFQSLASRSNPPSHVRITGIG 445
                ***********************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098531271445IPR005202Transcription factor GRAS
PfamPF035146.7E-49297445IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 445 aa     Download sequence    Send to blast
MLAGCSSSTL LSPRHRLRSE PSPQFHHQAC HLQLPPSMST QRLDLPACTF PRNNKVSPRP  60
SVVTTNTNTN KPIEAKTSSY SLKQHIRLPP LATTPQVITS APPSPFLEAK EEPFWDNNNN  120
NNNRSLKKRP VDNDDSFDSR GKRKKGSNSN SNSTSDNGDS SDDVMEEEGT GEGLSLSANF  180
WLQPSSLPPF SLTCSGEEER VCFVPSEVVS APWVESAITK ITNHGEKEGE GGGSRFPPPQ  240
PSASSNTSSE SQGLSLRLNE NPEVGNGSGN PYHNHHHEET TAEEDEDIQE EHRGFELVSL  300
LTACVEAIGT KNIAAINHFI AKLGDLASPR GTSSMSRICS YFTEALAIRV TRLWPHIFHI  360
TIPRELDRVV EDENGTALRL LNQITPIPKF LHFTSNEMLL RAFEGKDRVH IIDFDIKQGL  420
QWPSLFQSLA SRSNPPSHVR ITGIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A8e-1336844470147GRAS family transcription factor containing p
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1126144KKRPVDNDDSFDSRGKRKK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016201972.10.0PREDICTED: scarecrow-like protein 28
SwissprotQ9CAN31e-125SCL28_ARATH; Scarecrow-like protein 28
TrEMBLA0A061G6281e-165A0A061G628_THECC; GRAS family transcription factor
STRINGGLYMA05G03490.31e-161(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G63100.11e-114GRAS family protein